PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03957.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 296aa    MW: 34093.1 Da    PI: 6.6208
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03957.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-5261341128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeel+++yLk+kv++ ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rdkky++g r+nr tk+gyWk
  Rsa1.0_03957.1_g00002.1   6 LPPGFRFHPTDEELIDYYLKRKVKSLEIEL-EVIPVIDLYKFDPWELPdKsFLPNRDMEWFFFCSRDKKYPNGFRTNRGTKAGYWK 90 
                              79****************************.99**************96435556888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++++++++++g +ktLvfykgr+p g +t+W+mheyrl
  Rsa1.0_03957.1_g00002.1  91 ATGKDRKITCRSSSAIGYRKTLVFYKGRTPLGDRTTWIMHEYRL 134
                              ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-583160IPR003441NAC domain
PROSITE profilePS5100557.2986160IPR003441NAC domain
PfamPF023651.9E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI DYYLKRKVKS LEIELEVIPV IDLYKFDPWE LPDKSFLPNR  60
DMEWFFFCSR DKKYPNGFRT NRGTKAGYWK ATGKDRKITC RSSSAIGYRK TLVFYKGRTP  120
LGDRTTWIMH EYRLCDDESS LQGSQHYYKG AFVLCRVAKK NKIKTCSKIR GNLSEQALGS  180
GESSGYSSRV TSPSRDGTMP FHSFVNPVST ETDSSNIWIS PDFIFHSSEE YPQIQDFTSE  240
NLHDFDFPVI NNQNVDFPAG TLYSNVNQHM DESMQTGYWT NCGFDDTGLF GYTEFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-47616117166NO APICAL MERISTEM PROTEIN
1ut4_B4e-47616117166NO APICAL MERISTEM PROTEIN
1ut7_A4e-47616117166NO APICAL MERISTEM PROTEIN
1ut7_B4e-47616117166NO APICAL MERISTEM PROTEIN
3swm_A5e-47616120169NAC domain-containing protein 19
3swm_B5e-47616120169NAC domain-containing protein 19
3swm_C5e-47616120169NAC domain-containing protein 19
3swm_D5e-47616120169NAC domain-containing protein 19
3swp_A5e-47616120169NAC domain-containing protein 19
3swp_B5e-47616120169NAC domain-containing protein 19
3swp_C5e-47616120169NAC domain-containing protein 19
3swp_D5e-47616120169NAC domain-containing protein 19
4dul_A4e-47616117166NAC domain-containing protein 19
4dul_B4e-47616117166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00546DAPTransfer from AT5G46590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128881.10.0PREDICTED: NAC domain-containing protein 74-like
SwissprotQ9FFI52e-68NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A078DKD10.0A0A078DKD1_BRANA; BnaC02g32460D protein
STRINGBra022046.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.11e-169NAC domain containing protein 96